Star Sports -Hotstar live Cricket Streaming Guide APK
App information
Version 1.0 (#1)
Updated 2021-04-10
APK Size 6.7 MB
Requires Android Android 4.2+ (Jelly Bean)
Offered by VIVEK DHIMAN
Category Free Sports App
App id com.starsportsappfreenewliveapp.watchcricket_live_hotstar
Developer's notes Guide for Star Sports - live IPL match tips
Screenshot
Click on the image to see full size
Table of contents
Editor's review
Download the latest Star Sports -Hotstar live Cricket Streaming Guide application, version 1.0, compatible with Windows 10/11 (using emulators such as Bluestacks), Android devices. This free Sports app is developed by VIVEK DHIMAN and is easy to download and install.
Previous versions, including 1.0, are also available. If you need help or have any problems, please let us know.
Description
Features of this app:
Smooth UI;
Almost Every event cover timely;
Users are informed before every matches through notification;
Buffer less stream.
Guide For Watch the latest TV serials, movies, LIVE sports & stream LIVE Republic TV News Channel on your Android device for free. Tips Hotstar FREE HD TV is a live streaming app that lets you watch your favorite shows, jio movies, sports & live republic TV news on-the-go. Watch full episodes of your favorite shows; Hindi, English, Tamil, Kannada, Malayalam, Marathi, Telugu and Bengali in addition to live cricket, republic tv, other sports. TV gives live scores and the latest updating free streaming of videos and video highlights.
Tips Hotstar hd TV shows list also broadcasts regional channels that feature :
1. Malayalam TV shows2. Marathi TV shows. Tamil TV shows4. Telugu TV shows5. Bengali TV shows and much more.
Tamil TV: Captain TV,Jaya TV,Kalaignar TV,Makkal TV,Mega
If you follow this guide you will get all kind of videos Tips.
We are not using any others content, we are using only those which are available in public domain. So if you have any complaint about the content or any part of this app. We urge you please contact us immediately before taking any action. We assure you that review your issue as soon as possible and remove those.
If you Love Sports and Cricket Matches then you are the right place for this.This application provides you the best way to watch live sports and Cricket Matches.If you don't have any source to watch broadcasting of sports then come here and install our application AL-Wahid Sports TV.This application provides you all type of matches streaming like
World Cup Matches
T20 Series
T20 Cricket Matches
ODI Cricket Matches
Live PSL Matches
Champions League Sports
Hockey Matches
Europa League Watch
World Cup Finals
Pakistan Super League.
APPLICATION FEATURES:
- HD streaming
- Single Click Access
- comfortable and easy to use
- eye-catching Sight
- Easy and fastest Watch
- Easy to share with Others
.......................................................................................................................................................
DISCLAIMER NOTICE:
We don't own any content All rights are reserved by their respective owners in this application.We are just providing best way to sports lovers to watch Sports.In case of any problem please contact us by our personal email.
This Application does not afforde any copyright infringement.If you are a copyright owner of any content and you believe that any content on this app has violating your copyrights, please contact us at Perosnal Email.Thank You.
App permissions
Star Sports -Hotstar live Cricket Streaming Guide 1.0 APK requires following permissions:
Allows applications to access information about Wi-Fi networks.
Allows an app to access approximate location.
Allows an app to access precise location.
Allows an application to receive the ACTION_BOOT_COMPLETED that is broadcast after the system finishes booting.
Allows applications to connect to paired bluetooth devices.
Allows applications to open network sockets.
Allows applications to access information about networks.
Ratings and Reviews
Rating: 5.0/5 based on Less than 100 reviews
(*) is required
Previous versions
Star Sports -Hotstar live Cricket Streaming Guide 1.0 APK for Windows (#1, 6.7 MB)
Similar to Star Sports -Hotstar live Cricket Streaming Guide
Star Sports Live Cricket TV Streaming - Live Score APK
Star Sports Live Cricket TV Streaming Guide APK
Star Sports Live Cricket TV Streaming Guide APK
Star Sports Live Cricket Match 2021 APK
Live Star Sports - Live Cricket Match Guide APK
Guide For Star Sports Live Cricket - Live Cricket APK
Star Sports Live Cricket Tv Guide - Live Stream APK
Star Sports 3 Live Guide - Live Cricket TV Sports APK
More from VIVEK DHIMAN
HappyMod - Happy Apps Tips APK
Zee Tv show-live Serial -Hotstar Stream Guide 2021 APK
Free Colors TV - Live Serials- Color tv tip 2021 APK
Oreo TV Guide : Cricket Live TV-HOtstar Channels APK
Sony Pal - live Tip Serial Streaming Live 2021 APK
Top download apps
فیلتر شکن جدید و قوی،فیلتر شکن قوی و پرسرعت رایگان APK